PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF058700130CFD_t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 116aa    MW: 13270.2 Da    PI: 10.068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF058700130CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             rg+W++eEdell  +v+ +G   +W + +++ g++R++k+c++rw++yl
  TRAES3BF058700130CFD_t1 14 RGPWSPEEDELLRSYVRSHGAVsNWIALPQKAGLNRCGKSCRLRWLNYL 62
                             89******************88**************************7 PP

2Myb_DNA-binding36.71e-1171111446
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               T++Ed  +  + +  G++ W+ Ia++++ gRt++++k++w++
  TRAES3BF058700130CFD_t1  71 YTEQEDMVICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                              69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.277966IPR017930Myb domain
SuperFamilySSF466891.92E-2711109IPR009057Homeodomain-like
SMARTSM007175.4E-111364IPR001005SANT/Myb domain
PfamPF002491.7E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-251569IPR009057Homeodomain-like
CDDcd001671.67E-81662No hitNo description
PROSITE profilePS5129413.14167116IPR017930Myb domain
SMARTSM007172.5E-1067115IPR001005SANT/Myb domain
PfamPF002492.2E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2270116IPR009057Homeodomain-like
CDDcd001673.31E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDELLRSYVR SHGAVSNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG YTEQEDMVIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-26141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084521e-128AK108452.1 Oryza sativa Japonica Group cDNA clone:002-143-C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567000.13e-80PREDICTED: myb-related protein Myb4-like
SwissprotQ9M2Y97e-67RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0C4B8B74e-82A0A0C4B8B7_WHEAT; Uncharacterized protein
TrEMBLM0YNG18e-82M0YNG1_HORVD; Uncharacterized protein
STRINGMLOC_71129.12e-81(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-68myb domain protein 84
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]